DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and prkcz

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:XP_009302121.1 Gene:prkcz / 555737 ZFINID:ZDB-GENE-070511-1 Length:603 Species:Danio rerio


Alignment Length:337 Identity:159/337 - (47%)
Similarity:217/337 - (64%) Gaps:12/337 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  1565 DFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDD----DVDSTLIERKVLALGTKHP 1625
            ||..:.|:|:||:.||||..|:.....||:|.:||::|.:|:    |:|....|:.|....:.:|
Zfish   258 DFDLIRVIGRGSYAKVLLVRLKKNEQIYAMKVVKKELVHDDERKRKDIDWVQTEKHVFEQASTNP 322

  Fly  1626 YLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRD 1690
            :|..|...|||||.||.|:||:||||||||:|...:..||.||||.|||...|.|||:|||||||
Zfish   323 FLVGLHSCFQTESRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHEKGIIYRD 387

  Fly  1691 LKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLL 1755
            |||||||||.:||:::.|:||||..|....|..:|||||:|:||||::||.|..:||||:.|||:
Zfish   388 LKLDNVLLDQDGHIKLTDYGMCKEGIRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLM 452

  Fly  1756 YEMLIGQSPFS------GCDEDELFWSICNEIP-WFPVYISAEATGILKGLLEKDYTKRIGSQYS 1813
            :||:.|:|||.      ..:.:|..:.:..|.| ..|..:|.:|..:|||.|.||..:|:|.|..
Zfish   453 FEMMAGRSPFDIITDNPDMNTEEYLFQVILEKPIRIPRSLSVKAASVLKGFLNKDPKERLGCQVQ 517

  Fly  1814 PA-GDIADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILASMD 1877
            .. .||..|.|||.|||..||::|:.||||||:......:.||..||.|.|:|||.|::::..:|
Zfish   518 TGFTDIKSHTFFRSIDWDQLEQKQVTPPFKPQITDDYGLENFDTQFTNEPVQLTPDDEDVIKRID 582

  Fly  1878 QKQFHGFTYTNP 1889
            |.:|.||.|.||
Zfish   583 QSEFEGFEYINP 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 125/269 (46%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 155/330 (47%)
prkczXP_009302121.1 PB1 16..98 CDD:295447
C1_1 131..183 CDD:278556
STKc_aPKC_zeta 243..603 CDD:270768 159/337 (47%)
S_TKc 259..529 CDD:214567 125/269 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.