DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and akt2l

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:XP_021334818.1 Gene:akt2l / 403146 ZFINID:ZDB-GENE-040121-5 Length:625 Species:Danio rerio


Alignment Length:360 Identity:151/360 - (41%)
Similarity:215/360 - (59%) Gaps:24/360 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1527 SSPKKMLETSYTYSQFQKSGRFTAPATVIPRFKNYSVDDFHFLAVLGKGSFGKVLLAELRDTTYY 1591
            |||...|| .......:.|.|.|             ::||.:|.:||||:||||:|...:.:..|
Zfish   124 SSPSDALE-DMEMCLSKSSSRVT-------------MNDFDYLKLLGKGTFGKVILVREKASGMY 174

  Fly  1592 YAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHI 1656
            ||:|.|:|:|::..|:|..|:.|.:||. .|:||:|..|...|||...|.|||||.|||:|.||:
Zfish   175 YAMKILRKEVIIAKDEVAHTVTESRVLQ-NTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFHL 238

  Fly  1657 QESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKT 1721
            .....|||:|||||||||:|.|.:.|.:.::||.|||:|::||.:||::|.|||:||..|..:.|
Zfish   239 SRERVFSEDRARFYGAEIVSALDYPHSQNVVYRHLKLENLMLDNDGHIKITDFGLCKEGITDEAT 303

  Fly  1722 ADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEMLIGQSPFSGCDEDELFWSICNEIPWFPV 1786
            ..:|||||:|:|||:::...|.:.||||..||::|||:.|:.||...|.:.||..|..|...||.
Zfish   304 MRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYSQDHERLFEQIVMEEIRFPR 368

  Fly  1787 YISAEATGILKGLLEKDYTKRIGSQYSPAGDIADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDT 1851
            .:|..|..:|.|||.|:..:|:|.....|.|:..|.||..:.|..:.::::.|||||||....||
Zfish   369 SLSTHARALLTGLLRKEPKQRLGGGPDDARDVMMHKFFSGVQWDDVLQKKLLPPFKPQVTSETDT 433

  Fly  1852 QYFDRVFTRERVRLTPIDK---------EILASMD 1877
            :|||..||.:.:.:||.||         |:|...|
Zfish   434 RYFDDEFTAQSITVTPPDKLSCQDVEEPEVLEDND 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 118/257 (46%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 140/317 (44%)
akt2lXP_021334818.1 PH_PKB 4..111 CDD:269947
PKc_like 153..462 CDD:328722 137/309 (44%)
PKc_like <423..551 CDD:328722 19/46 (41%)
S_TK_X 553..621 CDD:214529
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.