DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and trc

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_001262071.1 Gene:trc / 40165 FlyBaseID:FBgn0003744 Length:463 Species:Drosophila melanogaster


Alignment Length:343 Identity:115/343 - (33%)
Similarity:173/343 - (50%) Gaps:59/343 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1563 VDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYL 1627
            |:||..|.|:|:|:||:|.|.:.:||.:.||:|.|:|..:||.:.|.....||.|| :...|.::
  Fly    90 VEDFEALKVIGRGAFGEVRLVQKKDTGHVYAMKVLRKADMLEKEQVAHVRAERDVL-VEADHQWV 153

  Fly  1628 CHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLK 1692
            ..::.:||...:|:.:||:|.|||:|..:.:....|||..:||.:|....:..:||.|.|:||:|
  Fly   154 VKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIHKLGFIHRDIK 218

  Fly  1693 LDNVLLDYEGHVRIADFGMC-------KLQIYLD----KTAD----------------------- 1723
            .||:|||..||::::|||:|       :...|.|    |.:|                       
  Fly   219 PDNLLLDARGHLKLSDFGLCTGLKKSHRTDFYRDLSQAKPSDFIGTCASLSCSPMDSKRRAESWK 283

  Fly  1724 --------SFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEMLIGQSPFSGCDEDELFWSICNE 1780
                    |..|||||:|||:.....|....||||.||::||||:|..||...:..:.:..:.| 
  Fly   284 RNRRALAYSTVGTPDYIAPEVFLQTGYGPACDWWSLGVIMYEMLMGYPPFCSDNPQDTYRKVMN- 347

  Fly  1781 IPW-----FP--VYISAEA-TGILKGLLEKDYTKRIGSQYSPAGDIADHIFFRPIDWGLLEKRQI 1837
              |     ||  :.||.|| ..|:....|.|  :|:|||.. ..|:....|||.:||..:.:|..
  Fly   348 --WRETLIFPPEIPISEEAKETIINFCCEAD--RRLGSQRG-LEDLKSVPFFRGVDWEHIRERPA 407

  Fly  1838 EPPFKPQVKHPLDTQYFD 1855
            ..|.  :|:...||..||
  Fly   408 AIPV--EVRSIDDTSNFD 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 101/307 (33%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 111/336 (33%)
trcNP_001262071.1 OmpH 16..>85 CDD:214922
STKc_NDR_like 91..455 CDD:270750 114/342 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.