DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and akt2

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_937789.1 Gene:akt2 / 378972 ZFINID:ZDB-GENE-031007-5 Length:479 Species:Danio rerio


Alignment Length:330 Identity:148/330 - (44%)
Similarity:218/330 - (66%) Gaps:5/330 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1562 SVDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPY 1626
            ::.||.:|.:||||:||||:|...:.|..|||:|.|:|:|::..|:|..|:.|.:||. .|:||:
Zfish   146 TMSDFDYLKLLGKGTFGKVILVREKATGMYYAMKILRKEVIIAKDEVAHTITESRVLQ-NTRHPF 209

  Fly  1627 LCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDL 1691
            |..|...|||...|.|||||.|||:|.||:.....|:|:|||||||||:|.|::||.|.::||||
Zfish   210 LTTLKYAFQTRDRLCFVMEYANGGELFFHLSRERVFTEDRARFYGAEIVSALEYLHSKDVVYRDL 274

  Fly  1692 KLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLY 1756
            ||:|::||.:||::|.|||:||..|..:.|..:|||||:|:|||:::...|.:.||||..||::|
Zfish   275 KLENLMLDKDGHIKITDFGLCKEGITNEATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMY 339

  Fly  1757 EMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADH 1821
            ||:.|:.||...|.:.||..|..|...||..:|.||..:|.|||:||..:|:|.....|.::..|
Zfish   340 EMMCGRLPFYNQDHERLFELILMEEIRFPRNLSPEAKALLAGLLKKDPKQRLGGGPEDAKEVMTH 404

  Fly  1822 IFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDK-EILASMD---QKQFH 1882
            .||..::|..:.::::.|||||||....||:|||..||.:.:.:||.|: :.|.:.|   :..|.
Zfish   405 KFFNNMNWQDVLQKKLVPPFKPQVTSETDTRYFDDEFTAQTITVTPPDQYDSLDAEDPDTRTHFS 469

  Fly  1883 GFTYT 1887
            .|:|:
Zfish   470 QFSYS 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 122/257 (47%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 145/322 (45%)
akt2NP_937789.1 PH_PKB 4..111 CDD:269947
PH 6..106 CDD:278594
S_TKc 150..407 CDD:214567 122/257 (47%)
STKc_PKB_beta 154..476 CDD:173686 145/322 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.