DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and inaC

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster


Alignment Length:330 Identity:161/330 - (48%)
Similarity:218/330 - (66%) Gaps:1/330 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1565 DFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCH 1629
            ||:|:.|:||||||||||||.|.|...||:|.|:|||:::.||::..:.|:|:|||..:.|:|..
  Fly   370 DFNFVKVIGKGSFGKVLLAERRGTDELYAVKVLRKDVIIQTDDMELPMNEKKILALSGRPPFLVS 434

  Fly  1630 LFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLD 1694
            :...|||...|||||||..|||||:|:|:.|||.|..|.||..|:...|.|||::.|||||||||
  Fly   435 MHSCFQTMDRLFFVMEYCKGGDLMYHMQQYGRFKESVAIFYAVEVAIALFFLHERDIIYRDLKLD 499

  Fly  1695 NVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEML 1759
            |:|||.||||::.|||:.|..:...:|..:|||||:||||||:..:.|:...|||||||||:|.:
  Fly   500 NILLDGEGHVKLVDFGLSKEGVTERQTTRTFCGTPNYMAPEIVSYDPYSIAADWWSFGVLLFEFM 564

  Fly  1760 IGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADHIFF 1824
            .||:||.|.||..:|.:|.::...||.:.|.||..|:...|.|....|:|:......:|..|.||
  Fly   565 AGQAPFEGDDETTVFRNIKDKKAVFPKHFSVEAMDIITSFLTKKPNNRLGAGRYARQEITTHPFF 629

  Fly  1825 RPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILASMDQKQFHGFTYTNP 1889
            |.:||...|..::|||.||.:||..|...||..||:|:..|||.||..:.::||..|.||::.||
  Fly   630 RNVDWDKAEACEMEPPIKPMIKHRKDISNFDDAFTKEKTDLTPTDKLFMMNLDQNDFIGFSFMNP 694

  Fly  1890 H-ITL 1893
            . ||:
  Fly   695 EFITI 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 127/257 (49%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 154/318 (48%)
inaCNP_476863.1 C1_1 72..124 CDD:278556
C1_1 137..189 CDD:278556
C2_PKC_alpha_gamma 194..324 CDD:175992
S_TKc 371..629 CDD:214567 127/257 (49%)
STKc_PKC 375..692 CDD:270722 154/316 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452324
Domainoid 1 1.000 46 1.000 Domainoid score I3535
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I1276
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143719at33208
OrthoFinder 1 1.000 - - FOG0000117
OrthoInspector 1 1.000 - - otm46471
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.