DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and sgk1

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:XP_005162356.1 Gene:sgk1 / 324140 ZFINID:ZDB-GENE-030131-2860 Length:598 Species:Danio rerio


Alignment Length:335 Identity:145/335 - (43%)
Similarity:203/335 - (60%) Gaps:21/335 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1565 DFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCH 1629
            ||.||.|:|||||||||||..|....:||:|.|:|..:|:..:....:.||.||....|||:|..
Zfish   264 DFDFLKVIGKGSFGKVLLARHRSDEKFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVG 328

  Fly  1630 LFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLD 1694
            |..:|||...|:||::|:|||:|.:|:|....|.|.|||||.|||.|.|.:||...|:|||||.:
Zfish   329 LHYSFQTTDKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPE 393

  Fly  1695 NVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEML 1759
            |:|||.:||:.:.|||:||..|..:.|..:|||||:|:|||::..:.|::.||||..|.:|||||
Zfish   394 NILLDSQGHIILTDFGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEML 458

  Fly  1760 IGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIG--SQYSPAGDIADHI 1822
            .|..||...:..|::.:|.|:.......||..|..:|:|||:||.|||:|  ..::   :|.:|:
Zfish   459 YGLPPFYSRNTAEMYDNILNKPLQLKPNISNAARHLLEGLLQKDRTKRLGFTDDFT---EIKNHM 520

  Fly  1823 FFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILASMDQ--------- 1878
            ||.||:|..|..:::.|||.|.|..|.|.::||..||.|     |:...|..|.|.         
Zfish   521 FFSPINWDDLNAKKLTPPFNPNVTGPNDLRHFDPEFTDE-----PVPNSIGCSPDSALVTSSITE 580

  Fly  1879 --KQFHGFTY 1886
              :.|.||:|
Zfish   581 ATEAFLGFSY 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 118/259 (46%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 141/330 (43%)
sgk1XP_005162356.1 STKc_SGK1 257..595 CDD:270753 145/335 (43%)
S_TKc 265..522 CDD:214567 118/259 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.