DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and Akt3

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:XP_038946556.1 Gene:Akt3 / 29414 RGDID:62390 Length:504 Species:Rattus norvegicus


Alignment Length:271 Identity:129/271 - (47%)
Similarity:183/271 - (67%) Gaps:1/271 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1559 KNYSVDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTK 1623
            |..:::||.:|.:||||:||||:|...:.:..|||:|.|||:|::..|:|..||.|.:||. .|:
  Rat   164 KRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLK-NTR 227

  Fly  1624 HPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIY 1688
            ||:|..|..:|||:..|.|||||:|||:|.||:.....|||:|.|||||||:|.|.:||...|:|
  Rat   228 HPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVY 292

  Fly  1689 RDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGV 1753
            |||||:|::||.:||::|.|||:||..|....|..:|||||:|:|||:::...|.:.||||..||
  Rat   293 RDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGV 357

  Fly  1754 LLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDI 1818
            ::|||:.|:.||...|.::||..|..|...||..:|::|..:|.|||.||..||:|.....|.:|
  Rat   358 VMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEI 422

  Fly  1819 ADHIFFRPIDW 1829
            ..|.||..::|
  Rat   423 MRHSFFSGVNW 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 124/257 (48%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 125/260 (48%)
Akt3XP_038946556.1 PH_PKB 4..133 CDD:269947
PKc_like 175..442 CDD:419665 125/260 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.