DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and Prkcz

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:XP_038965237.1 Gene:Prkcz / 25522 RGDID:3399 Length:605 Species:Rattus norvegicus


Alignment Length:335 Identity:158/335 - (47%)
Similarity:219/335 - (65%) Gaps:8/335 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1563 VDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYL 1627
            :.||..:.|:|:||:.||||..|:.....||:|.:||::|.:|:|:|....|:.|....:.:|:|
  Rat   262 LQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFL 326

  Fly  1628 CHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLK 1692
            ..|...|||.|.||.|:||:||||||||:|...:..||.||||.|||...|.|||::||||||||
  Rat   327 VGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLK 391

  Fly  1693 LDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYE 1757
            |||||||.:||:::.|:||||..:....|..:|||||:|:||||::||:|..:||||:.|||::|
  Rat   392 LDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFE 456

  Fly  1758 MLIGQSPFSGC-------DEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQ-YSP 1814
            |:.|:|||...       .||.||..|..:....|.::|.:|:.:|||.|.||..:|:|.: .:.
  Rat   457 MMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTG 521

  Fly  1815 AGDIADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILASMDQK 1879
            ..||..|.|||.|||.||||:|..|||:||:........||..||.|.|:|||.|::::..:||.
  Rat   522 FSDIKSHAFFRSIDWDLLEKKQTLPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQS 586

  Fly  1880 QFHGFTYTNP 1889
            :|.||.|.||
  Rat   587 EFEGFEYINP 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 123/265 (46%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 154/326 (47%)
PrkczXP_038965237.1 PB1_aPKC 16..98 CDD:99725
C1_aPKC_zeta 129..183 CDD:410448
STKc_aPKC_zeta 249..605 CDD:270768 158/335 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.