DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and Akt3

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_035915.3 Gene:Akt3 / 23797 MGIID:1345147 Length:479 Species:Mus musculus


Alignment Length:335 Identity:151/335 - (45%)
Similarity:219/335 - (65%) Gaps:7/335 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1559 KNYSVDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTK 1623
            |..:::||.:|.:||||:||||:|...:.:..|||:|.|||:|::..|:|..||.|.:||. .|:
Mouse   141 KRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLK-NTR 204

  Fly  1624 HPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIY 1688
            ||:|..|..:|||:..|.|||||:|||:|.||:.....|||:|.|||||||:|.|.:||...|:|
Mouse   205 HPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVY 269

  Fly  1689 RDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGV 1753
            |||||:|::||.:||::|.|||:||..|....|..:|||||:|:|||:::...|.:.||||..||
Mouse   270 RDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGV 334

  Fly  1754 LLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDI 1818
            ::|||:.|:.||...|.::||..|..|...||..:|::|..:|.|||.||..||:|.....|.:|
Mouse   335 VMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEI 399

  Fly  1819 ADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTP---IDKEILASMDQKQ 1880
            ..|.||..::|..:..:::.|||||||....||:|||..||.:.:.:||   .|.:.:..||.::
Mouse   400 MRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNER 464

  Fly  1881 ---FHGFTYT 1887
               |..|:|:
Mouse   465 RPHFPQFSYS 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 124/257 (48%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 147/324 (45%)
Akt3NP_035915.3 PH_PKB 4..110 CDD:269947
STKc_PKB_gamma 132..479 CDD:270745 151/335 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 445..479 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.