DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and SGK3

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_001028750.1 Gene:SGK3 / 23678 HGNCID:10812 Length:496 Species:Homo sapiens


Alignment Length:333 Identity:144/333 - (43%)
Similarity:200/333 - (60%) Gaps:11/333 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  1565 DFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCH 1629
            ||.||.|:|||||||||||:.:....:||:|.|:|.:||...:....:.||.||....|||:|..
Human   161 DFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVG 225

  Fly  1630 LFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLD 1694
            |..:|||...|:||::::|||:|.||:|....|.|.|||||.|||.|.|.:||...|:|||||.:
Human   226 LHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPE 290

  Fly  1695 NVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEML 1759
            |:|||..|||.:.|||:||..|.:..|..:|||||:|:|||:|:.:.|:..||||..|.:|||||
Human   291 NILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEML 355

  Fly  1760 IGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADHIFF 1824
            .|..||...|..|::.:|.::.......:|..|..||:.|||||...|:|:: ....:|.:|.||
Human   356 YGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAK-EDFLEIQNHPFF 419

  Fly  1825 RPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTP--------IDKEILASMDQKQF 1881
            ..:.|..|.:::|.|||.|.|..|.|.:.||..||.|.|..:.        ::..:|.:.|  .|
Human   420 ESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADD--AF 482

  Fly  1882 HGFTYTNP 1889
            .||:|..|
Human   483 VGFSYAPP 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 118/257 (46%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 139/326 (43%)
SGK3NP_001028750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PX_CISK 12..120 CDD:132780
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..156
STKc_SGK3 165..490 CDD:270755 140/327 (43%)
Nuclear localization signal. /evidence=ECO:0000250 195..205 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.