DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and Prkcq

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_032885.1 Gene:Prkcq / 18761 MGIID:97601 Length:707 Species:Mus musculus


Alignment Length:446 Identity:204/446 - (45%)
Similarity:277/446 - (62%) Gaps:49/446 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1457 DAVAMVTKAGSSNATTVLDSSN-------------SSGSNAGTLSVPSAGSGSGGGASTSSSPSI 1508
            :|:||:  ..:..|.::.||.:             |:.:......||:.|.....|.|.      
Mouse   290 EALAMI--ESTQQARSLRDSEHIFREGPVEIGLPCSTKNETRPPCVPTPGKREPQGISW------ 346

  Fly  1509 IRMSTCSNDSGFEGGTAPSSPKKMLETSYTYSQFQKSGRFTAPATVIPRFKNYSVDDFHFLAVLG 1573
                    ||..:|....:.|.:. |.|...:..|               ....:|||....:||
Mouse   347 --------DSPLDGSNKSAGPPEP-EVSMRRTSLQ---------------LKLKIDDFILHKMLG 387

  Fly  1574 KGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCTFQTES 1638
            |||||||.|||.:.|..::|||.|||||||.||||:.|::|::||:|..:||:|.|:||||||:.
Mouse   388 KGSFGKVFLAEFKRTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKE 452

  Fly  1639 HLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLLDYEGH 1703
            :||||||||||||||:|||...:|...||.||.||:|.||:|||.|||:||||||||:|||.:||
Mouse   453 NLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGH 517

  Fly  1704 VRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEMLIGQSPFSGC 1768
            ::||||||||..:..|...::|||||||:||||:.|:|||.:|||||||||:||||||||||.|.
Mouse   518 IKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLVYEMLIGQSPFHGQ 582

  Fly  1769 DEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADHIFFRPIDWGLLE 1833
            ||:|||.||..:.|::|.::..||..:|..|..::..||:|.:    |||..|..||.|:|..||
Mouse   583 DEEELFHSIRMDNPFYPRWLEREAKDLLVKLFVREPEKRLGVR----GDIRQHPLFREINWEELE 643

  Fly  1834 KRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILASMDQKQFHGFTYTNP 1889
            :::|:|||:|:||.|.|...||:.|..|:.||:..|:.::.||||..|..|::.||
Mouse   644 RKEIDPPFRPKVKSPYDCSNFDKEFLSEKPRLSFADRALINSMDQNMFSNFSFINP 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 153/257 (60%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 180/318 (57%)
PrkcqNP_032885.1 C1_1 160..212 CDD:278556
C1_1 232..284 CDD:278556
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..365 10/52 (19%)
STKc_nPKC_theta 374..704 CDD:270770 185/330 (56%)
S_TKc 380..634 CDD:214567 153/257 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 336 1.000 Domainoid score I1118
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 611 1.000 Inparanoid score I916
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45425
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000117
OrthoInspector 1 1.000 - - otm42516
orthoMCL 1 0.900 - - OOG6_105998
Panther 1 1.100 - - O PTHR24356
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R891
SonicParanoid 1 1.000 - - X125
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.