DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and Prkch

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_032882.2 Gene:Prkch / 18755 MGIID:97600 Length:683 Species:Mus musculus


Alignment Length:420 Identity:203/420 - (48%)
Similarity:264/420 - (62%) Gaps:39/420 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1481 GSNAGTLSVPSAGSGSGGGASTSSSPSIIRMSTCSNDSGFEG-----GTAPSSPKKMLETSYTYS 1540
            |.||..|:...||.|...| :.|.:..:|..||... .|.||     |...:|            
Mouse   296 GVNAVELAKTLAGMGLQPG-NISPTSKLISRSTLRR-QGKEGSKEGNGIGVNS------------ 346

  Fly  1541 QFQKSGRFTAPATVIPRFKNYSVDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLED 1605
                |.||             .:|:|.|:.||||||||||:||.:::|...||:|.|||||:|:|
Mouse   347 ----SSRF-------------GIDNFEFIRVLGKGSFGKVMLARIKETGELYAVKVLKKDVILQD 394

  Fly  1606 DDVDSTLIERKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFY 1670
            |||:.|:.|:::|:|...||:|..|||.|||...||||||::||||||||||:|.||.|.|||||
Mouse   395 DDVECTMTEKRILSLARNHPFLTQLFCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFY 459

  Fly  1671 GAEIISGLKFLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPE 1735
            .|||||.|.|||:||||||||||||||||:|||.::|||||||..|....|..:|||||||:|||
Mouse   460 AAEIISALMFLHEKGIIYRDLKLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPE 524

  Fly  1736 IIKGEKYNQNVDWWSFGVLLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLL 1800
            |::...|...||||:.||||||||.|.:||...:||:||.:|.|:...:|.::..:||||||..:
Mouse   525 ILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFM 589

  Fly  1801 EKDYTKRIGSQYSPAG--DIADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERV 1863
            .|:.|.|:|| .:..|  :|..|.||:.|||..|..||:||||:|::|...|...||..|.:|..
Mouse   590 TKNPTMRLGS-LTQGGEHEILRHPFFKEIDWAQLNHRQLEPPFRPRIKSREDVSNFDPDFIKEEP 653

  Fly  1864 RLTPIDKEILASMDQKQFHGFTYTNPHITL 1893
            .|||||:..|..::|.:|..|:|.:|.:.|
Mouse   654 VLTPIDEGHLPMINQDEFRNFSYVSPELQL 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 151/259 (58%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 178/320 (56%)
PrkchNP_032882.2 C2_PKC_epsilon 8..140 CDD:175981
C1_1 172..222 CDD:365894
C1_1 246..296 CDD:365894 203/420 (48%)
STKc_nPKC_eta 359..681 CDD:270742 179/322 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839312
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D222529at2759
OrthoFinder 1 1.000 - - FOG0000117
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R891
SonicParanoid 1 1.000 - - X125
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.