DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and F48G7.10

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_503273.1 Gene:F48G7.10 / 185998 WormBaseID:WBGene00018621 Length:168 Species:Caenorhabditis elegans


Alignment Length:41 Identity:13/41 - (31%)
Similarity:19/41 - (46%) Gaps:1/41 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PSSPRSPSSYSSGSSGGSSSLHGLGSRYQPKLTTITETGRH 100
            |||||.|......|..|... |.:.|..:|:::|.....:|
 Worm    80 PSSPRQPPPQELSSDSGELR-HRIPSPTEPQVSTNHHFNKH 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567
STKc_nPKC_theta_like 1570..1889 CDD:270744
F48G7.10NP_503273.1 C1_1 27..76 CDD:278556
C1_1 114..166 CDD:278556 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000117
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.