powered by:
Protein Alignment Pkcdelta and F48G7.10
DIOPT Version :9
Sequence 1: | NP_572797.3 |
Gene: | Pkcdelta / 32191 |
FlyBaseID: | FBgn0259680 |
Length: | 1894 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_503273.1 |
Gene: | F48G7.10 / 185998 |
WormBaseID: | WBGene00018621 |
Length: | 168 |
Species: | Caenorhabditis elegans |
Alignment Length: | 41 |
Identity: | 13/41 - (31%) |
Similarity: | 19/41 - (46%) |
Gaps: | 1/41 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 PSSPRSPSSYSSGSSGGSSSLHGLGSRYQPKLTTITETGRH 100
|||||.|......|..|... |.:.|..:|:::|.....:|
Worm 80 PSSPRQPPPQELSSDSGELR-HRIPSPTEPQVSTNHHFNKH 119
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000117 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.