DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and sgk-1

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_001041299.1 Gene:sgk-1 / 181697 WormBaseID:WBGene00004789 Length:463 Species:Caenorhabditis elegans


Alignment Length:338 Identity:135/338 - (39%)
Similarity:206/338 - (60%) Gaps:6/338 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1559 KNYSVDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTK 1623
            |..:.:||.:|..:||||||:|.....::|...||:|.|.|:.:.:.::|...:.||.||....|
 Worm   128 KTATANDFDYLTTIGKGSFGRVYQVRHKETKKIYAMKILSKEHIRKKNEVKHVMAERNVLINNFK 192

  Fly  1624 HPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIY 1688
            ||:|..|..:||.:..|:||:::||||:|..|:|....|||.|:|||.|||...|.:||:|.|||
 Worm   193 HPFLVSLHFSFQNKEKLYFVLDHLNGGELFSHLQREKHFSESRSRFYAAEIACALGYLHEKNIIY 257

  Fly  1689 RDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGV 1753
            ||||.:|:|||.:|::.:.|||:||..:...||..:|||||:|:|||||..:.|::.||||..|.
 Worm   258 RDLKPENLLLDDKGYLVLTDFGLCKEDMQGSKTTSTFCGTPEYLAPEIILKKPYDKTVDWWCLGS 322

  Fly  1754 LLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDI 1818
            :||||:.|..||...|.:|::..|.|:.......||...:.::.|||:||.:||:|.: :...||
 Worm   323 VLYEMIFGLPPFYSKDHNEMYDKIINQPLRLKHNISVPCSELITGLLQKDRSKRLGHR-NDFRDI 386

  Fly  1819 ADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERV---RLTPIDKEILASMDQKQ 1880
            .||.||.|:||..|..|:::.||.|:||:.:||....:.|...::   .|.|  :::..:.....
 Worm   387 RDHPFFLPVDWDKLLNRELKAPFIPKVKNAMDTSNISKEFVEIQIDPSSLAP--QQLAVTHRDHD 449

  Fly  1881 FHGFTYTNPHITL 1893
            |..||:.:.:..|
 Worm   450 FENFTFVDTNRVL 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 112/257 (44%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 130/321 (40%)
sgk-1NP_001041299.1 S_TKc 135..392 CDD:214567 112/257 (44%)
STKc_SGK 139..456 CDD:270727 130/319 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.