DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and RSKR

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:NP_001167574.1 Gene:RSKR / 124923 HGNCID:26314 Length:410 Species:Homo sapiens


Alignment Length:365 Identity:108/365 - (29%)
Similarity:181/365 - (49%) Gaps:48/365 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1523 GTAPSSPKKMLETSYTYSQFQKSGRFTAPATV--------IPRFKNYSVDDF-----------HF 1568
            ||..|..:::.|....:...|:|.: .||..|        :|:|.|..:.:|           ..
Human    46 GTIRSDLEELWELRGHHYLHQESLK-PAPVLVEKPLPEWPVPQFINLFLPEFPIRPIRGQQQLKI 109

  Fly  1569 LAVLGKGSFGKVLLAELRDTTY--YYAIKCLKKDVVLEDDDV----DSTLIERKVLALGTKHPYL 1627
            |.::.|||||.||  ::.|.|.  .:|:|.:.|..||:.|.|    :...|:|::     .||::
Human   110 LGLVAKGSFGTVL--KVLDCTQKAVFAVKVVPKVKVLQRDTVRQCKEEVSIQRQI-----NHPFV 167

  Fly  1628 CHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLK 1692
            ..|..::|.:.|||.:..|.: .||.......|.|.|...|.:.||::..|.:||..||::||:|
Human   168 HSLGDSWQGKRHLFIMCSYCS-TDLYSLWSAVGCFPEASIRLFAAELVLVLCYLHDLGIMHRDVK 231

  Fly  1693 LDNVLLDYEGHVRIADFGMCKLQIYLDKTADSF--CGTPDYMAPEIIKGEKYNQNVDWWSFGVLL 1755
            ::|:|||..||:::.|||:.:   ::.:.|.::  |||..|||||::.|..||...||||.||||
Human   232 MENILLDERGHLKLTDFGLSR---HVPQGAQAYTICGTLQYMAPEVLSGGPYNHAADWWSLGVLL 293

  Fly  1756 YEMLIGQSPFSG-CDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIA 1819
            :.:..|:.|.:. .|...:..|:.:.....|..::...:.:|..||.::...|:  :|.....: 
Human   294 FSLATGKFPVAAERDHVAMLASVTHSDSEIPASLNQGLSLLLHELLCQNPLHRL--RYLHHFQV- 355

  Fly  1820 DHIFFRPI--DWGLLEKRQIEPPFKPQVKHP--LDTQYFD 1855
             |.|||.:  |..||:|:.:....:.|...|  .:|..||
Human   356 -HPFFRGVAFDPELLQKQPVNFVTETQATQPSSAETMPFD 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 84/277 (30%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 94/299 (31%)
RSKRNP_001167574.1 S_TKc 108..324 CDD:214567 76/226 (34%)
STKc_AGC 115..359 CDD:270693 82/258 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.