DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and sgk3

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:XP_012820716.1 Gene:sgk3 / 100491891 XenbaseID:XB-GENE-492582 Length:490 Species:Xenopus tropicalis


Alignment Length:392 Identity:154/392 - (39%)
Similarity:222/392 - (56%) Gaps:10/392 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1507 SIIRMSTCSNDSGFEGGTAPSSPKKMLETSYTYSQ--FQKSGRFTAPATVIPRFKNYS-VDDFHF 1568
            :::|.|...:.|..:......|||...:.|....:  .||:|..:....:.|....:: ..||.:
 Frog    94 NLLRHSELCSHSDVQSFLQLDSPKHQSDPSEDEDERVDQKNGSASRDVNLGPSGNPHAKPSDFEY 158

  Fly  1569 LAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTKHPYLCHLFCT 1633
            |.::||||||||:|...:....|||:|.|:|:|:|...:....:.||.||....|||:|..|..:
 Frog   159 LKLIGKGSFGKVVLTRGKRDGRYYAVKVLQKNVILNKKEQRHIMAERNVLLKNVKHPFLVTLHYS 223

  Fly  1634 FQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIYRDLKLDNVLL 1698
            |||...||||::::|||:|.||:|....|:|.||.||.|||.|.|.:||...|||||||.:|:||
 Frog   224 FQTSDKLFFVLDFINGGELFFHLQRERYFAEPRALFYAAEIGSALGYLHSIDIIYRDLKPENILL 288

  Fly  1699 DYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGVLLYEMLIGQS 1763
            |.:||:.:.|||:||..|....|..:|||||:|:|||:|..:.|:..||||..|.:|||||.|..
 Frog   289 DSQGHIVLTDFGLCKEGISNSDTTLTFCGTPEYLAPEVIVKQPYDNTVDWWCLGSVLYEMLHGLP 353

  Fly  1764 PFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDIADHIFFRPID 1828
            ||...|...::.:|.::.......||..|..||:.|||||...|:|.. :...||.:|.||..|:
 Frog   354 PFYNRDTATMYENILHKPLTTRPDISLPAISILEELLEKDPKLRLGVN-NDFQDIKNHAFFASIN 417

  Fly  1829 WGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLT---PIDKEIL-ASMDQKQ--FHGFTYT 1887
            |..|.::::.||:.|.|..|.|...||:.||.|.|..:   ..|..|: ||:::..  |.||:|.
 Frog   418 WADLVEKKMTPPYDPHVNGPDDISNFDKEFTEEMVPYSVCVSSDYSIVNASVEEADDAFVGFSYA 482

  Fly  1888 NP 1889
            .|
 Frog   483 PP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 116/257 (45%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 139/324 (43%)
sgk3XP_012820716.1 PX_domain 7..114 CDD:383026 3/19 (16%)
STKc_SGK3 159..484 CDD:270755 140/325 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.