powered by:
Protein Alignment Pkcdelta and gpha2
DIOPT Version :9
Sequence 1: | NP_572797.3 |
Gene: | Pkcdelta / 32191 |
FlyBaseID: | FBgn0259680 |
Length: | 1894 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031756486.1 |
Gene: | gpha2 / 100490777 |
XenbaseID: | XB-GENE-492809 |
Length: | 125 |
Species: | Xenopus tropicalis |
Alignment Length: | 51 |
Identity: | 13/51 - (25%) |
Similarity: | 18/51 - (35%) |
Gaps: | 14/51 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 1336 SSVDGCANLSASMKKKLRKEKKKQKAKAAAAAEAKRFDPHKKIKIDTTNKC 1386
:|...|..:| |.||.|........| |::|:|.|...|
Frog 79 TSASQCCTIS-----------KMQKVKVQLYCGGSR---HEEIEIGTALSC 115
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Pkcdelta | NP_572797.3 |
S_TKc |
1566..1824 |
CDD:214567 |
|
STKc_nPKC_theta_like |
1570..1889 |
CDD:270744 |
|
gpha2 | XP_031756486.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.