DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and gpha2

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:XP_031756486.1 Gene:gpha2 / 100490777 XenbaseID:XB-GENE-492809 Length:125 Species:Xenopus tropicalis


Alignment Length:51 Identity:13/51 - (25%)
Similarity:18/51 - (35%) Gaps:14/51 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1336 SSVDGCANLSASMKKKLRKEKKKQKAKAAAAAEAKRFDPHKKIKIDTTNKC 1386
            :|...|..:|           |.||.|........|   |::|:|.|...|
 Frog    79 TSASQCCTIS-----------KMQKVKVQLYCGGSR---HEEIEIGTALSC 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567
STKc_nPKC_theta_like 1570..1889 CDD:270744
gpha2XP_031756486.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.