DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and akt3b

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:XP_001923454.3 Gene:akt3b / 100149794 ZFINID:ZDB-GENE-110309-3 Length:479 Species:Danio rerio


Alignment Length:335 Identity:152/335 - (45%)
Similarity:216/335 - (64%) Gaps:7/335 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1559 KNYSVDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIERKVLALGTK 1623
            |..:::||.:|.:||||:||||:|...:.:..|||:|.|||:|::..|:|..||.|.:||. .|:
Zfish   141 KRKTMNDFDYLKLLGKGTFGKVILVREKASGTYYAMKILKKEVIIAKDEVAHTLTESRVLK-NTR 204

  Fly  1624 HPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLKFLHKKGIIY 1688
            ||:|..|..:|||:..|.|||||:|||:|.||:.....|||:|.|||||||:|.|.:||...|:|
Zfish   205 HPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSAKIVY 269

  Fly  1689 RDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQNVDWWSFGV 1753
            |||||:|::||.:||::|.|||:||..|....|..:|||||:|:|||:::...|.:.||||..||
Zfish   270 RDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGV 334

  Fly  1754 LLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIGSQYSPAGDI 1818
            ::|||:.|:.||...|.::||..|..|...||..:||:|..:|.|||.||..||:|.....|.:|
Zfish   335 VMYEMMCGRLPFYNQDHEKLFELILMEEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEI 399

  Fly  1819 ADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILASMD------ 1877
            ..|.||..:||..:..:::.|||.|||....||:|||..||.:.:.:||.:|.....||      
Zfish   400 MRHSFFTALDWQDVYDKKLVPPFMPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMDAADSER 464

  Fly  1878 QKQFHGFTYT 1887
            :..|..|:|:
Zfish   465 RPHFPQFSYS 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 125/257 (49%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 148/324 (46%)
akt3bXP_001923454.3 PH_PKB 4..109 CDD:269947
PH 6..105 CDD:278594
PKc_like 132..479 CDD:304357 152/335 (45%)
S_TKc 148..405 CDD:214567 125/257 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.