DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and prkcq

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:XP_012813823.2 Gene:prkcq / 100038268 XenbaseID:XB-GENE-487643 Length:699 Species:Xenopus tropicalis


Alignment Length:405 Identity:203/405 - (50%)
Similarity:263/405 - (64%) Gaps:40/405 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1497 GGGASTSSSPSIIRMSTCSNDSGFEG-------GTAPSSPKKMLETS-----YTYSQFQKSGRFT 1549
            |...:|...|.::.:...|....:|.       ..:|..|:..:|.|     .|:|         
 Frog   316 GPTTNTQDQPIVLSIKKESQGISWESPIESIKVQESPPEPELKIEQSSCQIKVTFS--------- 371

  Fly  1550 APATVIPRFKNYSVDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIE 1614
                           ||....:|||||||||.||||:.|..::|||.|||||||.||||:.|::|
 Frog   372 ---------------DFVLHKMLGKGSFGKVFLAELKRTNQFFAIKVLKKDVVLMDDDVECTMVE 421

  Fly  1615 RKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLK 1679
            ::||:|..:||:|.||:|||||:.|||||||||||||||||||...:|...||.||.|||:.||:
 Frog   422 KRVLSLAWEHPFLTHLYCTFQTKEHLFFVMEYLNGGDLMFHIQSCHKFDLPRATFYAAEIVCGLQ 486

  Fly  1680 FLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQ 1744
            |||.||::||||||||:|||.|||::||||||||..:..|....:|||||||:||||:.|:|||.
 Frog   487 FLHSKGVVYRDLKLDNILLDMEGHIKIADFGMCKESMLGDAKTSTFCGTPDYIAPEILLGQKYNY 551

  Fly  1745 NVDWWSFGVLLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIG 1809
            :||||||||||||||||||||.|.||:|||.||..:.|.:|.::|.||..||..|..::..:|:|
 Frog   552 SVDWWSFGVLLYEMLIGQSPFHGIDEEELFQSIRMDNPMYPRFLSMEAKDILIMLFVREPERRLG 616

  Fly  1810 SQYSPAGDIADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILA 1874
            .:    |||..|.||:.||||.||.|:|||||||:||...|...||:.|..|:.||:..::.::.
 Frog   617 VK----GDIRQHCFFQHIDWGRLENREIEPPFKPKVKSADDWSNFDKEFLNEKPRLSSSERTLIN 677

  Fly  1875 SMDQKQFHGFTYTNP 1889
            ||||..|:.|::.||
 Frog   678 SMDQNMFNNFSFVNP 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 158/257 (61%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 188/318 (59%)
prkcqXP_012813823.2 C1_nPKC_theta-like_rpt1 150..210 CDD:410384
C1_nPKC_theta-like_rpt2 229..278 CDD:410387
STKc_nPKC_theta 367..697 CDD:270770 194/354 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 336 1.000 Domainoid score I1125
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 609 1.000 Inparanoid score I910
OMA 1 1.010 - - QHG45425
OrthoDB 1 1.010 - - D222529at2759
OrthoFinder 1 1.000 - - FOG0000117
OrthoInspector 1 1.000 - - otm47618
Panther 1 1.100 - - O PTHR24356
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R891
SonicParanoid 1 1.000 - - X125
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.