DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkcdelta and prkcg

DIOPT Version :9

Sequence 1:NP_572797.3 Gene:Pkcdelta / 32191 FlyBaseID:FBgn0259680 Length:1894 Species:Drosophila melanogaster
Sequence 2:XP_001921715.1 Gene:prkcg / 100003514 ZFINID:ZDB-GENE-090206-1 Length:695 Species:Danio rerio


Alignment Length:339 Identity:181/339 - (53%)
Similarity:235/339 - (69%) Gaps:1/339 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1550 APATVIPRFKNYSVDDFHFLAVLGKGSFGKVLLAELRDTTYYYAIKCLKKDVVLEDDDVDSTLIE 1614
            |||.:.....:..:.||:||.||||||||||||||.:.:...:|||.|||||:.:|:|.:|.::|
Zfish   347 APAVLHTGKGHIGLHDFNFLMVLGKGSFGKVLLAEEKGSERLFAIKMLKKDVLFQDEDTESAMVE 411

  Fly  1615 RKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAEIISGLK 1679
            |:||||..:..:|..|:|.||||..|::||||:||||||||||..|:|.|..|.||.|||..||.
Zfish   412 RRVLALSGRPHFLTSLYCAFQTEDRLYYVMEYVNGGDLMFHIQIVGKFKEPHAAFYAAEIAVGLF 476

  Fly  1680 FLHKKGIIYRDLKLDNVLLDYEGHVRIADFGMCKLQIYLDKTADSFCGTPDYMAPEIIKGEKYNQ 1744
            |||.||||||||||||||||.|||::|||||||:..:....|..:|||||||:||||:..:.|.:
Zfish   477 FLHNKGIIYRDLKLDNVLLDSEGHIKIADFGMCREGMMEGDTTRTFCGTPDYIAPEIVAYQPYGK 541

  Fly  1745 NVDWWSFGVLLYEMLIGQSPFSGCDEDELFWSICNEIPWFPVYISAEATGILKGLLEKDYTKRIG 1809
            .|||||:||||||||.||.||.|.||:|||.||..:...:|..:|.||..|.||||.|:..||:|
Zfish   542 AVDWWSYGVLLYEMLAGQPPFDGIDEEELFQSIMEQSVSYPKSLSREAVAICKGLLTKNPAKRLG 606

  Fly  1810 SQYSPAGDIADHIFFRPIDWGLLEKRQIEPPFKPQVKHPLDTQYFDRVFTRERVRLTPIDKEILA 1874
            .......::.:|.|||.|||..||:.:|:|||||: ......:.||:.||.....|||.|.::||
Zfish   607 GGEDAERELREHPFFRWIDWDRLERLEIQPPFKPR-SGGKKGENFDKFFTSTSSALTPSDPDVLA 670

  Fly  1875 SMDQKQFHGFTYTN 1888
            :::|::|..||:.|
Zfish   671 AINQEEFQDFTFMN 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PkcdeltaNP_572797.3 S_TKc 1566..1824 CDD:214567 148/257 (58%)
STKc_nPKC_theta_like 1570..1889 CDD:270744 174/319 (55%)
prkcgXP_001921715.1 C1_1 56..108 CDD:278556
C1_1 121..173 CDD:278556
C2_PKC_alpha_gamma 178..308 CDD:175992
S_TKc 363..621 CDD:214567 148/257 (58%)
STKc_cPKC 366..684 CDD:270739 174/318 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583330
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143719at33208
OrthoFinder 1 1.000 - - FOG0000117
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X125
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.