DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and UBC11

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_014984.3 Gene:UBC11 / 854517 SGDID:S000005866 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:138 Identity:50/138 - (36%)
Similarity:79/138 - (57%) Gaps:2/138 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GCVV-RIKSELQDIRKNPPPNCTA-DLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFR 124
            |||. |:::||..:..:...:.:| .:...||.:|...:.||..:.|.|..|::.::||.:|||.
Yeast     7 GCVTKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFH 71

  Fly   125 APRIRFTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYK 189
            .|.|:|.:.::|.|||..|.||||:|.|:||.|.||..:|||:..|:.|.|...||....|:.:.
Yeast    72 PPMIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWD 136

  Fly   190 TNRREHDK 197
            .:..|:.|
Yeast   137 ADMEEYRK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 47/133 (35%)
UQ_con 66..203 CDD:278603 47/133 (35%)
UBC11NP_014984.3 COG5078 11..156 CDD:227410 47/134 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.