DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and PEX4

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_011649.1 Gene:PEX4 / 853034 SGDID:S000003365 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:133 Identity:47/133 - (35%)
Similarity:66/133 - (49%) Gaps:15/133 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CVVRIKSELQDIRK---------NPPPNCTADLH---HGDLLHWTAGVNGPVGSVYEGGHFRLDI 115
            |:.||..|.:.|.|         ||.......|:   ..||..|.|.::||..:.||...||:.|
Yeast    18 CMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILI 82

  Fly   116 RFPASYPFRAPRIRF-TTRIYHCNVDS-RGAICLDVL-GERWSPVMNVAKVLLSIYVLMSECNPD 177
            ..|:|||...|:|.| ...|.||||.| .|.|||::| .|.|:||.::...:.:::.|:.|...|
Yeast    83 EVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCD 147

  Fly   178 DPL 180
            .||
Yeast   148 SPL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 46/130 (35%)
UQ_con 66..203 CDD:278603 46/130 (35%)
PEX4NP_011649.1 COG5078 15..176 CDD:227410 47/133 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.