DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and UBC8

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_568595.2 Gene:UBC8 / 834173 AraportID:AT5G41700 Length:149 Species:Arabidopsis thaliana


Alignment Length:147 Identity:69/147 - (46%)
Similarity:102/147 - (69%) Gaps:7/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RIKSELQDIRKNPPPNCTADLHHG----DLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAP 126
            ||..||:|::|:||.:|   :..|    |:.||.|.:.||..|.|.||.|.:.|.||..|||:.|
plant     5 RILKELKDLQKDPPTSC---IFAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPP 66

  Fly   127 RIRFTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTN 191
            ::.|.|:::|.|::|.|:||||:|.|:|||.:.::||||||..|:::.|||||||..||..|||:
plant    67 KVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 131

  Fly   192 RREHDKIARHWTKLFAM 208
            |.:::..||:||:.:||
plant   132 RAKYEATARNWTQKYAM 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 67/145 (46%)
UQ_con 66..203 CDD:278603 65/140 (46%)
UBC8NP_568595.2 COG5078 1..148 CDD:227410 67/145 (46%)
UBCc 1..147 CDD:294101 67/144 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.