DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and UBC9

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_567791.1 Gene:UBC9 / 828909 AraportID:AT4G27960 Length:178 Species:Arabidopsis thaliana


Alignment Length:143 Identity:68/143 - (47%)
Similarity:101/143 - (70%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRF 130
            ||..||:|::|:||.:|:|.....|:.||.|.:.||..|.|.||.|.:.|.||..|||:.|::.|
plant    35 RILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAF 99

  Fly   131 TTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREH 195
            .|:::|.|::|.|:||||:|.|:|||.:.::||||||..|:::.|||||||..||..|||::.::
plant   100 RTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKY 164

  Fly   196 DKIARHWTKLFAM 208
            :..||.||:.:||
plant   165 ESTARTWTQKYAM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 66/141 (47%)
UQ_con 66..203 CDD:278603 64/136 (47%)
UBC9NP_567791.1 COG5078 31..177 CDD:227410 66/141 (47%)
UBCc 31..176 CDD:294101 66/140 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.