DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and UBC12

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001319500.1 Gene:UBC12 / 820017 AraportID:AT3G08700 Length:149 Species:Arabidopsis thaliana


Alignment Length:144 Identity:66/144 - (45%)
Similarity:100/144 - (69%) Gaps:1/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RIKSELQDIRKNPPPNCTA-DLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIR 129
            ||..||:|::::||.||:| .:...|:.||.|.:.||..|.|.||.|.:.|.|.:.|||:.|::.
plant     5 RISRELRDMQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPYSGGVFTVSIDFSSDYPFKPPKVN 69

  Fly   130 FTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRRE 194
            |.|::||.|:||:|:||||:|.|:|||....:||||||..|:::.||:||||..||..||.::.:
plant    70 FKTKVYHPNIDSKGSICLDILKEQWSPAPTTSKVLLSICSLLTDPNPNDPLVPEIAHLYKVDKSK 134

  Fly   195 HDKIARHWTKLFAM 208
            ::..|:.||:.:||
plant   135 YESTAQKWTQKYAM 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 64/142 (45%)
UQ_con 66..203 CDD:278603 62/137 (45%)
UBC12NP_001319500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.