DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and Ube2r2

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001121045.1 Gene:Ube2r2 / 689226 RGDID:1594826 Length:238 Species:Rattus norvegicus


Alignment Length:170 Identity:52/170 - (30%)
Similarity:85/170 - (50%) Gaps:26/170 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ELQDIRKNPPPNCTADL-HHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTR 133
            ||:.:::.|.......| ...||.:|...:.||..::||||:|:..|:||..||:..|..||.|:
  Rat    16 ELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTK 80

  Fly   134 IYHCNVDSRGAICLDVL-------------GERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIA 185
            ::|.|:...|.:|:.:|             .|||:|..||..:|||:..|::|.|...|..:..:
  Rat    81 MWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDAS 145

  Fly   186 DQYKTNR------REHDKIARHWTKLFAMTKAQDKNREKD 219
            ..::..|      :|:.:|.|   |..:.|||:   .|||
  Rat   146 VMFRKWRDSKGKDKEYAEIIR---KQVSATKAE---AEKD 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 46/157 (29%)
UQ_con 66..203 CDD:278603 45/152 (30%)
Ube2r2NP_001121045.1 UBCc 11..169 CDD:238117 46/155 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.