DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and Ube2t

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001265044.1 Gene:Ube2t / 67196 MGIID:1914446 Length:204 Species:Mus musculus


Alignment Length:184 Identity:66/184 - (35%)
Similarity:97/184 - (52%) Gaps:12/184 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRF 130
            |:|.||..:...|||..|.......:....|.:.|...:.||.|.|.|::..|..|||..|::||
Mouse     6 RLKKELHMLAIEPPPGITCWQEKDQVADLRAQILGGANTPYEKGVFTLEVIIPERYPFEPPQVRF 70

  Fly   131 TTRIYHCNVDSRGAICLDVL----GERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTN 191
            .|.|||.|:||.|.||||:|    ...|.|.:|:|.||.||.:||:|.||||||:..|:.::|.|
Mouse    71 LTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEPNPDDPLMADISSEFKYN 135

  Fly   192 RREHDKIARHWTKLFAMTKAQDKNRE-------KDADQGNE-QNQEENPMPGQQ 237
            :....|.|:.||:..|..|.:....|       .|:::.:. |.::..|:.|.:
Mouse   136 KIAFLKKAKQWTEAHARQKQKADEEELGTSSEVGDSEESHSTQKRKARPLGGME 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 59/145 (41%)
UQ_con 66..203 CDD:278603 57/140 (41%)
Ube2tNP_001265044.1 COG5078 1..151 CDD:227410 59/144 (41%)
UBCc 5..147 CDD:238117 57/140 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..204 7/40 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.