DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and Ube2w

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_006495620.1 Gene:Ube2w / 66799 MGIID:1914049 Length:174 Species:Mus musculus


Alignment Length:144 Identity:46/144 - (31%)
Similarity:72/144 - (50%) Gaps:14/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RIKSELQDIRKNPPPNCTADLH--HGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRI 128
            |::.||..::.:|||..|.:..  ...:..|...:.|..|::|||..|:|..:|.:.|||.:|::
Mouse    36 RLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQV 100

  Fly   129 RFTTR--IYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTN 191
            .||..  ..|.:|.|.|.|||.:|.|.|||.::|..|.|||..::|.|...      |....:..
Mouse   101 MFTGENIPIHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEK------ILSLMEVG 159

  Fly   192 RREHDKIARHWTKL 205
            :|..:|    |.:|
Mouse   160 KRPDEK----WCEL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 46/144 (32%)
UQ_con 66..203 CDD:278603 44/140 (31%)
Ube2wXP_006495620.1 UQ_con 36..>148 CDD:365926 40/111 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.