DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and ube2e1

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001096586.1 Gene:ube2e1 / 563542 ZFINID:ZDB-GENE-071004-16 Length:195 Species:Danio rerio


Alignment Length:189 Identity:91/189 - (48%)
Similarity:120/189 - (63%) Gaps:13/189 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SRASVASSVEETAPST----SHSASGKSTEAP---------LTGCVVRIKSELQDIRKNPPPNCT 83
            ||||.:||...::.||    .....||..|:.         |:....||:.||.||..:|||||:
Zfish     6 SRASSSSSSSSSSSSTHQQQEKDTPGKKKESKANMSKTSKLLSTSAKRIQKELADIMLDPPPNCS 70

  Fly    84 ADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTRIYHCNVDSRGAICLD 148
            |.....::..|.:.:.||.|||||||.|.|||.|...|||:.|::.|.|||||||::|:|.||||
Zfish    71 AGPKGDNIYEWRSTILGPPGSVYEGGVFFLDIAFTPDYPFKPPKVTFRTRIYHCNINSQGVICLD 135

  Fly   149 VLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHDKIARHWTKLFA 207
            :|.:.|||.:.::||||||..|:::|||.||||..||.||.|||.|||:||:.|||.:|
Zfish   136 ILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYTTNRPEHDRIAKQWTKRYA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 79/142 (56%)
UQ_con 66..203 CDD:278603 75/136 (55%)
ube2e1NP_001096586.1 COG5078 48..194 CDD:227410 78/145 (54%)
UQ_con 53..190 CDD:278603 75/136 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.