DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and UBE2D4

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_024302563.1 Gene:UBE2D4 / 51619 HGNCID:21647 Length:192 Species:Homo sapiens


Alignment Length:193 Identity:84/193 - (43%)
Similarity:119/193 - (61%) Gaps:10/193 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RARAEVEVEVEPEVLSRASV-ASSVEETAPSTSHSASGKSTEAPLTGCVVRIKSELQDIRKNPPP 80
            |:.||| ....|...:|:.| ||:..|.:.|.......|..:|    |.:    ||.|::::||.
Human     9 RSSAEV-TGFYPAGCTRSMVPASASGEASGSLQSWQKAKEKQA----CHL----ELTDLQRDPPA 64

  Fly    81 NCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTRIYHCNVDSRGAI 145
            .|:|.....||.||.|.:.||..|.|:||.|.|.|.||..|||:.|::.|||:|||.|::|.|:|
Human    65 QCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSI 129

  Fly   146 CLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHDKIARHWTKLFAM 208
            |||:|..:|||.:.|:||||||..|:.:.|||||||..||..||.:|.:::::||.||:.:||
Human   130 CLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 68/141 (48%)
UQ_con 66..203 CDD:278603 66/136 (49%)
UBE2D4XP_024302563.1 UBCc 54..191 CDD:320784 68/136 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.