DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and ube2z

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001007969.2 Gene:ube2z / 493338 XenbaseID:XB-GENE-990986 Length:313 Species:Xenopus tropicalis


Alignment Length:180 Identity:55/180 - (30%)
Similarity:86/180 - (47%) Gaps:24/180 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TAPSTSHS------ASGKSTEAPLTGCVVRIKSELQDIRKNPPPN--CTADLHHGDLLHWTAGVN 99
            |:|.|:.|      ::....|.....||:|||.::..|.|.|||.  ...|.|....:|  |.:.
 Frog    33 TSPLTTSSVWDPTASADWDNERASNQCVLRIKRDIMSIYKEPPPGMFVVPDPHDMTKIH--ALIT 95

  Fly   100 GPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTR-----IYHCNVDSRGAICLDVL----GERWS 155
            ||..:.||||.|....|.|..||...||::..|.     .::.|....|.:||.:|    |..||
 Frog    96 GPFDTPYEGGFFLFLFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWS 160

  Fly   156 PVMNVAKVLLSIYVLMSECNP--DDPLVMCIADQYKTNRREHDKIARHWT 203
            |..:::.||:||..||:| ||  ::|...  .:::..:.:.:::..||.|
 Frog   161 PAQSLSSVLISIQSLMTE-NPYHNEPGFE--QERHSGDSKNYNECIRHET 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 48/151 (32%)
UQ_con 66..203 CDD:278603 47/149 (32%)
ube2zNP_001007969.2 UBCc 62..207 CDD:238117 47/149 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.