DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and CG5823

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster


Alignment Length:134 Identity:37/134 - (27%)
Similarity:62/134 - (46%) Gaps:9/134 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 STSHSASGKSTEAPLTGCVVRIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGH 110
            |:|.::.|:....    .|.|:|.:...::::|.|..||:....::|.|...|.||..|.|.||:
  Fly     2 SSSSTSGGRKQPT----AVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCVKGPEDSPYYGGY 62

  Fly   111 FRLDIRFPASYPFRAPRIRFTTRIYHCNVDSRGAICL---DVLGERWSPVMNVAKVLLSIYVLMS 172
            :...:.||..:||:.|.|...|.......::|  :||   |...:.|:|...|..:|..:...|.
  Fly    63 YHGTLLFPREFPFKPPSIYMLTPNGRFKTNTR--LCLSISDFHPDTWNPTWCVGTILTGLLSFML 125

  Fly   173 ECNP 176
            |..|
  Fly   126 ESTP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 33/114 (29%)
UQ_con 66..203 CDD:278603 33/114 (29%)
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 33/114 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.