DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and ube2e3

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_012825720.2 Gene:ube2e3 / 394925 XenbaseID:XB-GENE-980957 Length:256 Species:Xenopus tropicalis


Alignment Length:211 Identity:94/211 - (44%)
Similarity:128/211 - (60%) Gaps:9/211 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSDQVNSQTEMETEARARAEVEVEVEPEVLSRASVASSVEETAPST----SHSASGKSTEAPLT 61
            ||||:..|..|..:.:...::.:....|     |......||..||.    .::.....|.|.|:
 Frog    50 MSSDRQRSDDESPSTSSGSSDADQRDPP-----APEPEEQEERKPSAVQQKKNTKLSSKTTAKLS 109

  Fly    62 GCVVRIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAP 126
            ....||:.||.:|..:|||||:|.....::..|.:.:.||.|||||||.|.|||.|.:.|||:.|
 Frog   110 TSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPP 174

  Fly   127 RIRFTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTN 191
            ::.|.|||||||::|:|.||||:|.:.|||.:.::||||||..|:::|||.||||..||.||.||
 Frog   175 KVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTN 239

  Fly   192 RREHDKIARHWTKLFA 207
            |.|||:|||.|||.:|
 Frog   240 RAEHDRIARQWTKRYA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 79/142 (56%)
UQ_con 66..203 CDD:278603 75/136 (55%)
ube2e3XP_012825720.2 UQ_con 114..251 CDD:395127 75/136 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.