DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and ube2e1

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_031759149.1 Gene:ube2e1 / 394629 XenbaseID:XB-GENE-941508 Length:230 Species:Xenopus tropicalis


Alignment Length:163 Identity:71/163 - (43%)
Similarity:98/163 - (60%) Gaps:18/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SRASVASS--------VEETAPSTSHSASGKSTEAP----------LTGCVVRIKSELQDIRKNP 78
            ||||.:||        :|...|..:.:.|.|..|:.          |:....||:.||.||..:|
 Frog     6 SRASTSSSSSSSSSQHIERQEPGNNSTNSNKKKESKGSSMSKNSKLLSTSAKRIQKELADITLDP 70

  Fly    79 PPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTRIYHCNVDSRG 143
            ||||:|.....::..|.:.:.||.|||||||.|.|||.|...|||:.|::.|.|||||||::|:|
 Frog    71 PPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQG 135

  Fly   144 AICLDVLGERWSPVMNVAKVLLSIYVLMSECNP 176
            .||||:|.:.|||.:.::||||||..|:::|||
 Frog   136 VICLDILKDNWSPALTISKVLLSICSLLTDCNP 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 59/111 (53%)
UQ_con 66..203 CDD:278603 59/111 (53%)
ube2e1XP_031759149.1 UQ_con 58..>168 CDD:395127 57/109 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.