DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and ube2nb

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_956636.1 Gene:ube2nb / 393313 ZFINID:ZDB-GENE-040426-1291 Length:154 Species:Danio rerio


Alignment Length:148 Identity:63/148 - (42%)
Similarity:91/148 - (61%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LTGCVVRIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFR 124
            :.|...||..|.|.:...|.|...|:...|:..::...:.||..|.:|||.|:|::..|..||..
Zfish     1 MAGLPRRIIKETQRLLAEPVPGIKAEPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMA 65

  Fly   125 APRIRFTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYK 189
            ||::||.|:|||.|||..|.||||:|.::|||.:.:..|||||..|:|..||||||...:|:|:|
Zfish    66 APKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWK 130

  Fly   190 TNRREHDKIARHWTKLFA 207
            :|..:..:.||.||:|:|
Zfish   131 SNEAQAIETARTWTRLYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 62/142 (44%)
UQ_con 66..203 CDD:278603 58/136 (43%)
ube2nbNP_956636.1 UBCc 4..151 CDD:412187 62/145 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.