DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and Ubc4

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster


Alignment Length:157 Identity:60/157 - (38%)
Similarity:88/157 - (56%) Gaps:22/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VVRIKSELQDI-RKNPPPNCTADLHHGDLLH--WT---AGVNGPVGSVYEGGHFRLDIRFPASYP 122
            |.|||.|.::: |......|:..:   :|::  ||   ..:.||..:.||||.|.|:|:.|.:||
  Fly     6 VSRIKREFKEVMRSEEIVQCSIKI---ELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYP 67

  Fly   123 FRAPRIRFTTRIYHCNVDS-RGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIAD 186
            |..|::||.|||:|.|:.| .||||||:|.:.|:..|.:..||||:..|::...||||....:|.
  Fly    68 FNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAY 132

  Fly   187 QYKTNRREHDK------IARHWTKLFA 207
            |:|      ||      .|:|||..:|
  Fly   133 QFK------DKYDLFLLTAKHWTNAYA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 59/155 (38%)
UQ_con 66..203 CDD:278603 56/149 (38%)
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 59/155 (38%)
UQ_con 8..149 CDD:278603 56/149 (38%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.