DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and Uev1A

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster


Alignment Length:124 Identity:33/124 - (26%)
Similarity:54/124 - (43%) Gaps:13/124 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TGCVV----RIKSELQDIRKNPPPNCTA-DLHHGD---LLHWTAGVNGPVGSVYEGGHFRLDIRF 117
            ||.||    |:..||...:|.......: .|.:.|   |.:|...:.||..:.:|...:.|.|..
  Fly     7 TGVVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIEC 71

  Fly   118 PASYPFRAPRIRFTTRI-YHCNVDSRGAI---CLDVLGERWSPVMNVAKVLLSIYVLMS 172
            ...||...|.:||.|:: .:|...:.|.:   .:.:|. |||...|:..:|..|..:|:
  Fly    72 GERYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLA-RWSREYNIKTMLQEIRRIMT 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 29/115 (25%)
UQ_con 66..203 CDD:278603 29/115 (25%)
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 29/115 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.