DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and CG7220

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001097261.1 Gene:CG7220 / 36129 FlyBaseID:FBgn0033544 Length:190 Species:Drosophila melanogaster


Alignment Length:185 Identity:59/185 - (31%)
Similarity:83/185 - (44%) Gaps:24/185 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EVEVEPEVLSRASVASSVEETAPSTSHSASGKSTEAPLTGCVVRIKSELQDIRKNPPPNCTADLH 87
            |:..||:           |...|..  |..||..:...:....|:..||..:.|.|||..|.|..
  Fly    16 EILTEPK-----------EPKTPPV--SKCGKPLQLDNSRWERRLHKELMSLIKEPPPGVTIDTE 67

  Fly    88 --HGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRF--TTRIYHCNVDSRGAICLD 148
              ..:|..|...:.|..|::|||..|:|..:|...|||.:|.:.|  |....|.:|.|.|.|||.
  Fly    68 SVQQNLSEWKINIKGFEGTLYEGEDFQLLFKFNNKYPFDSPEVTFIGTNIPVHPHVYSNGHICLS 132

  Fly   149 VLGERWSPVMNVAKVLLSIYVLMSECN-----PDDPLVM--CIADQYKTNRREHD 196
            :|.|.|||.::|..|.|||..::|.|.     ||:.:.:  |..:..||....||
  Fly   133 ILTEDWSPALSVQSVCLSIASMLSSCREKKRPPDNTIYVKTCNKNPKKTKWWYHD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 51/142 (36%)
UQ_con 66..203 CDD:278603 51/142 (36%)
CG7220NP_001097261.1 UQ_con 46..187 CDD:278603 49/140 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.