DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and Ubc2

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001260362.1 Gene:Ubc2 / 34487 FlyBaseID:FBgn0015320 Length:232 Species:Drosophila melanogaster


Alignment Length:205 Identity:91/205 - (44%)
Similarity:123/205 - (60%) Gaps:31/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ASVASSVEETA-PSTSHS--------------ASGKST--------EAPLTGCV--------VRI 67
            ::.||:|..|: |:|:.:              |||.:.        ||..|..:        .||
  Fly    27 STTASNVSNTSQPTTAGTPQARGGRGSNANGGASGSNAGGGDEPRKEAKTTPRISRALGTSAKRI 91

  Fly    68 KSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTT 132
            :.||.:|..:|||||:|.....:|..|.:.:.||.|||||||.|.|||.|...|||:.|::.|.|
  Fly    92 QKELAEITLDPPPNCSAGPKGDNLYEWVSTILGPPGSVYEGGVFFLDIHFSPEYPFKPPKVTFRT 156

  Fly   133 RIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHDK 197
            ||||||::|:|.||||:|.:.|||.:.::||||||..|:::|||.||||..||.||..||.|||:
  Fly   157 RIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNREEHDR 221

  Fly   198 IARHWTKLFA 207
            |||.|||.:|
  Fly   222 IARLWTKRYA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 79/142 (56%)
UQ_con 66..203 CDD:278603 75/136 (55%)
Ubc2NP_001260362.1 COG5078 86..231 CDD:227410 78/144 (54%)
UQ_con 90..227 CDD:278603 75/136 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451041
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S139
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103748at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.