Sequence 1: | NP_572796.1 | Gene: | CG2574 / 32190 | FlyBaseID: | FBgn0030386 | Length: | 239 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001260362.1 | Gene: | Ubc2 / 34487 | FlyBaseID: | FBgn0015320 | Length: | 232 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 91/205 - (44%) |
---|---|---|---|
Similarity: | 123/205 - (60%) | Gaps: | 31/205 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 ASVASSVEETA-PSTSHS--------------ASGKST--------EAPLTGCV--------VRI 67
Fly 68 KSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTT 132
Fly 133 RIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHDK 197
Fly 198 IARHWTKLFA 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2574 | NP_572796.1 | COG5078 | 66..208 | CDD:227410 | 79/142 (56%) |
UQ_con | 66..203 | CDD:278603 | 75/136 (55%) | ||
Ubc2 | NP_001260362.1 | COG5078 | 86..231 | CDD:227410 | 78/144 (54%) |
UQ_con | 90..227 | CDD:278603 | 75/136 (55%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45451041 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0417 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S139 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D103748at33392 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24068 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.800 |