DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and morgue

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_608833.1 Gene:morgue / 33648 FlyBaseID:FBgn0027609 Length:491 Species:Drosophila melanogaster


Alignment Length:122 Identity:48/122 - (39%)
Similarity:68/122 - (55%) Gaps:11/122 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 HWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTRIYHCNVDSRGAICLDVLGE-RWSP 156
            :|.|.:.||.||.||||.|.|.|.||..||...|.:||.|:|.|.||...|.:.:|:..: .||.
  Fly   368 YWQATILGPPGSPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSRHGDVGIDIFQQHNWSL 432

  Fly   157 VMNVAKVLLSIYVLMSECNPDDPLV-MCIADQ----YKTNRREHDKIARHWTKLFAM 208
            .:||||||||:..|::     ||.. :|:..:    |:..|...:::.|.||..:||
  Fly   433 ALNVAKVLLSVQSLLT-----DPYTEVCMEPELGYIYEHERERFEQLVRAWTWKYAM 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 46/120 (38%)
UQ_con 66..203 CDD:278603 44/115 (38%)
morgueNP_608833.1 DUF3664 92..190 CDD:289191
F-box-like 234..275 CDD:289689
UQ_con 342..479 CDD:278603 44/115 (38%)
COG5078 355..485 CDD:227410 48/122 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.