DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and ube2d2l

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_956246.1 Gene:ube2d2l / 335444 ZFINID:ZDB-GENE-030131-7384 Length:147 Species:Danio rerio


Alignment Length:143 Identity:73/143 - (51%)
Similarity:99/143 - (69%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRF 130
            ||..||.|:.::||..|:|.....||.||.|.:.||..|.|:||.|.|.|.||..|||:.|::.|
Zfish     5 RIHKELTDLGRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAF 69

  Fly   131 TTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREH 195
            ||||||.|::|.|:||||:|..:|||.:.::||||||..|:.:.|||||||..||..|||:..::
Zfish    70 TTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDNEKY 134

  Fly   196 DKIARHWTKLFAM 208
            ::|||.||:.:||
Zfish   135 NRIAREWTQKYAM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 71/141 (50%)
UQ_con 66..203 CDD:278603 69/136 (51%)
ube2d2lNP_956246.1 UBCc 1..146 CDD:412187 71/140 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.