DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and CG8188

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster


Alignment Length:216 Identity:52/216 - (24%)
Similarity:91/216 - (42%) Gaps:51/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ASVASSVEETAPSTSHSASGKSTEAPLTGCVVRIKSELQDIRKNPPPNCTADLHHGDLLHWTAGV 98
            :|..|:||..:|.|                :.::..|||::...||......::..|:....|.:
  Fly     2 SSQYSNVENLSPQT----------------IRQVMRELQEMETTPPEGIKVLINESDVTDIQALI 50

  Fly    99 NGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKV 163
            :||.|:.|..|.||:.:.....:|...|:..|.|:|:|.||.:.|.||::.|.:.|.|.:.:..:
  Fly    51 DGPAGTPYAAGIFRVKLTLNKDFPLTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHI 115

  Fly   164 LLSIYVLMSECNPDDPL----VMCIADQYKTNRREHDKIARHWTKLFAM---------------- 208
            ||:|..|:...||:..|    ...:.::|.    ::.:.||..|::.|.                
  Fly   116 LLTIKCLLIVPNPESALNEEAGKMLLERYD----DYSQRARMMTEIHAQPAKCGVGAVGDAKDDG 176

  Fly   209 -----------TKAQDKNREK 218
                       .|.|||.:||
  Fly   177 GPSTKKHAGLDKKLQDKKKEK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 39/145 (27%)
UQ_con 66..203 CDD:278603 38/140 (27%)
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 41/166 (25%)
UBCc 16..155 CDD:238117 38/142 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.