DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and ube2l3b

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001076266.1 Gene:ube2l3b / 321943 ZFINID:ZDB-GENE-030131-662 Length:190 Species:Danio rerio


Alignment Length:186 Identity:58/186 - (31%)
Similarity:96/186 - (51%) Gaps:29/186 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EETAPSTSHSASGKSTEAPLTG-----------CVVRIK---------SELQDIRKNPPPNC-TA 84
            ||:|      ..|:.|:..:.|           |..|::         :||::|||:...|. ..
Zfish     3 EESA------GGGRGTQQQVFGVEIVEADGQIACYSRLQCLNLSLHSLTELEEIRKSGMKNFRNI 61

  Fly    85 DLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTRIYHCNVDSRGAICLDV 149
            .:...::|.| .|:..|....|:.|.||::|.|||.|||:.|:|.|.|:|||.|:|.:|.:||.|
Zfish    62 QVDESNILTW-QGLIVPDNPPYDKGAFRIEIIFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPV 125

  Fly   150 L-GERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREHDKIARHWTK 204
            : .|.|.|.....:|:.|:..|:::..|:.||...:|::|..:|::..|.|..:||
Zfish   126 ISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFFKNAEEFTK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 51/150 (34%)
UQ_con 66..203 CDD:278603 49/147 (33%)
ube2l3bNP_001076266.1 COG5078 44..186 CDD:227410 50/139 (36%)
UBCc 46..185 CDD:214562 50/137 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.