DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and ube2d3

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_005156599.1 Gene:ube2d3 / 321832 ZFINID:ZDB-GENE-030131-551 Length:148 Species:Danio rerio


Alignment Length:143 Identity:70/143 - (48%)
Similarity:100/143 - (69%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRF 130
            ||:.||.|:.::||..|:|.....|:.||.|.:.||..|.|:||.|.|.|.||..|||:.|::.|
Zfish     5 RIQKELTDLARDPPAQCSAGPVGDDVFHWQATIMGPNESPYQGGVFFLTIHFPTDYPFKPPKVAF 69

  Fly   131 TTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRREH 195
            ||||||.|::|.|:||||:|..:|||.:.::||||||..|:.:.|||||||..||..|||:..::
Zfish    70 TTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDTEKY 134

  Fly   196 DKIARHWTKLFAM 208
            :::|:.||:.:||
Zfish   135 NRMAKEWTEKYAM 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 68/141 (48%)
UQ_con 66..203 CDD:278603 66/136 (49%)
ube2d3XP_005156599.1 UBCc 1..146 CDD:412187 68/140 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.