DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and CG2924

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001284819.1 Gene:CG2924 / 31214 FlyBaseID:FBgn0023528 Length:397 Species:Drosophila melanogaster


Alignment Length:194 Identity:45/194 - (23%)
Similarity:76/194 - (39%) Gaps:55/194 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSDQVNS---QTEMETEARARAEVEVEVEPEVLSRASVASSVEETAPSTSHSASGKSTEAPLTG 62
            :..|.|.|   :.:||.|..|..|...:.:.:...:.||:.||:.|.                  
  Fly   179 LEMDDVRSTSKKDDMEVEHLATLEKLRQSQRQDYLKGSVSGSVQATD------------------ 225

  Fly    63 CVVRIKSELQDI------RKNPPPNCTADLHHGDLLHW-----TAGVNGPVGS------VYEG-G 109
               |:..||:||      :||   ..:.:|.:..:..|     :...:.|:.|      ..|| .
  Fly   226 ---RLMKELRDIYRSDAFKKN---MYSIELVNESIYEWNIRLKSVDPDSPLHSDLQMLKEKEGKD 284

  Fly   110 HFRLDIRFPASYPFRAPRIRFTTRIYHCNVDS-----RGAICLDVLGER-WSPVMNVAKVLLSI 167
            ...|:|.|..:|||..|.:    |:.|..:..     .||||:::|.:: ||....|..|::.|
  Fly   285 SILLNILFKETYPFEPPFV----RVVHPIISGGYVLIGGAICMELLTKQGWSSAYTVEAVIMQI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 32/126 (25%)
UQ_con 66..203 CDD:278603 32/126 (25%)
CG2924NP_001284819.1 UBCc 224..>349 CDD:238117 33/149 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.