DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and Ube2z

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001032732.2 Gene:Ube2z / 303478 RGDID:1308347 Length:356 Species:Rattus norvegicus


Alignment Length:170 Identity:53/170 - (31%)
Similarity:83/170 - (48%) Gaps:17/170 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PSTSHSASGKSTEAPLTGCVVRIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGG 109
            |:.|....|:.| ||  .|::|||.::..|.|.|||.........|:....|.:.||..:.||||
  Rat    87 PTLSSDWDGERT-AP--QCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGG 148

  Fly   110 HFRLDIRFPASYPFRAPRIRFTTR-----IYHCNVDSRGAICLDVL----GERWSPVMNVAKVLL 165
            .|....|.|..||...||::..|.     .::.|....|.:||.:|    |..|||..:::.||:
  Rat   149 FFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLI 213

  Fly   166 SIYVLMSECNP--DDPLVMCIADQYKTNRREHDKIARHWT 203
            ||..||:| ||  ::|...  .:::..:.:.:::..||.|
  Rat   214 SIQSLMTE-NPYHNEPGFE--QERHPGDSKNYNECIRHET 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 46/149 (31%)
UQ_con 66..203 CDD:278603 45/147 (31%)
Ube2zNP_001032732.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
UBCc 105..223 CDD:238117 40/118 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.