DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and ube2kb

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001008611.1 Gene:ube2kb / 30100 ZFINID:ZDB-GENE-980605-9 Length:200 Species:Danio rerio


Alignment Length:148 Identity:55/148 - (37%)
Similarity:87/148 - (58%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VVRIKSELQDIRKNPPPN---CTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRA 125
            |.|||.|.:::.|:...:   ...||...:.......:.||..:.||||.::|:|:.|.:|||..
Zfish     6 VQRIKREFKEVLKSEETSKNQIKVDLVDENFTELKGEIAGPPDTPYEGGRYQLEIKIPETYPFNP 70

  Fly   126 PRIRFTTRIYHCNVDS-RGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYK 189
            |::||.|:|:|.|:.| .||||||:|.::|:..|.:..||||:..|::...||||....:|:|||
Zfish    71 PKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYK 135

  Fly   190 TNRREHDKIARHWTKLFA 207
            .|.....:.||.|:.::|
Zfish   136 QNPEMFKQTARLWSHVYA 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 54/146 (37%)
UQ_con 66..203 CDD:278603 52/140 (37%)
ube2kbNP_001008611.1 UBCc 6..148 CDD:238117 53/141 (38%)
UBA_II_E2_UBE2K 163..200 CDD:270573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.