DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and UBE2T

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_054895.1 Gene:UBE2T / 29089 HGNCID:25009 Length:197 Species:Homo sapiens


Alignment Length:171 Identity:72/171 - (42%)
Similarity:92/171 - (53%) Gaps:21/171 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RIKSELQDIRKNPPP--NCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRI 128
            |:|.||..:...|||  .|..|....|.|.  |.:.|...:.||.|.|:|::..|..|||..|:|
Human     6 RLKRELHMLATEPPPGITCWQDKDQMDDLR--AQILGGANTPYEKGVFKLEVIIPERYPFEPPQI 68

  Fly   129 RFTTRIYHCNVDSRGAICLDVL----GERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYK 189
            ||.|.|||.|:||.|.||||||    ...|.|.:|:|.||.||.:||||.||||||:..|:.::|
Human    69 RFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFK 133

  Fly   190 TNRREHDKIARHWTKLFAMTKAQDKNREKDADQGNEQNQEE 230
            .|:....|.||.||             ||.|.|..:.::||
Human   134 YNKPAFLKNARQWT-------------EKHARQKQKADEEE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 66/147 (45%)
UQ_con 66..203 CDD:278603 64/142 (45%)
UBE2TNP_054895.1 UBCc 5..147 CDD:238117 64/142 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..197 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.