DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and ubc16

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_595078.1 Gene:ubc16 / 2539961 PomBaseID:SPBC1198.09 Length:160 Species:Schizosaccharomyces pombe


Alignment Length:126 Identity:42/126 - (33%)
Similarity:67/126 - (53%) Gaps:2/126 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DLLHWTAGVNGPVGSVYEGGHFRLDIRFPASYPFRAPRIRFTTRIYHCNVD-SRGAICLDVLGER 153
            |:.||.|.:.||..:.||||.:.|||.....||...|.:.|.|:|.|.|:. :.|.:|:|:|...
pombe    33 DMFHWKAVIEGPTETPYEGGQWVLDIHVHEGYPISPPSVYFQTKIVHPNISWTNGEVCMDILKTH 97

  Fly   154 WSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKT-NRREHDKIARHWTKLFAMTKAQD 213
            |||..::....|:|..|:|..:...||.:..|...:| ::..::.:.|..|.|:|..|.:|
pombe    98 WSPAWSLQSACLAIISLLSNYDASSPLNVDAAKLLRTGDKTAYNSLVRCTTYLYAKGKIED 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 39/119 (33%)
UQ_con 66..203 CDD:278603 37/114 (32%)
ubc16NP_595078.1 COG5078 3..153 CDD:227410 39/119 (33%)
UQ_con 7..145 CDD:278603 36/111 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.