DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2574 and Ube2dnl1

DIOPT Version :9

Sequence 1:NP_572796.1 Gene:CG2574 / 32190 FlyBaseID:FBgn0030386 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001263325.1 Gene:Ube2dnl1 / 237009 MGIID:3646570 Length:155 Species:Mus musculus


Alignment Length:152 Identity:69/152 - (45%)
Similarity:98/152 - (64%) Gaps:2/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PLTGCVV--RIKSELQDIRKNPPPNCTADLHHGDLLHWTAGVNGPVGSVYEGGHFRLDIRFPASY 121
            |..|.:.  ||:.||....::||.:|:|.....::.||.|.:.||..|.|:||.|.|.|.||.:|
Mouse     4 PSLGAMALKRIQKELVAFSQDPPAHCSAGPVAENMFHWQATIMGPEDSPYQGGVFFLSIHFPNNY 68

  Fly   122 PFRAPRIRFTTRIYHCNVDSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIAD 186
            ||:.|::.|.|||||.|:...|:||||:|..:|||.:.::||||||..|:.:.|.|||||..||.
Mouse    69 PFKPPKVSFITRIYHPNISKNGSICLDILNSKWSPTLTISKVLLSICSLLCDPNADDPLVPEIAK 133

  Fly   187 QYKTNRREHDKIARHWTKLFAM 208
            .|..:.||::::||.||:.|||
Mouse   134 VYHKDLREYNRLAREWTERFAM 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2574NP_572796.1 COG5078 66..208 CDD:227410 65/141 (46%)
UQ_con 66..203 CDD:278603 62/136 (46%)
Ube2dnl1NP_001263325.1 COG5078 9..155 CDD:227410 65/145 (45%)
UBCc 9..154 CDD:294101 64/144 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833300
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1337945at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.